PDB entry 1zv6

View 1zv6 on RCSB PDB site
Description: NMR structure of the human dematin headpiece S74E mutant
Class: protein binding
Keywords: dematin headpiece, actin binding domain, phosphorylation, PROTEIN BINDING
Deposited on 2005-06-01, released 2006-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: EPB49 protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • GB AAH52805 (0-67)
    • engineered (65)
  Domains in SCOPe 2.08: d1zv6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zv6A (A:)
  pglqiypyemlvvtnkgrtklppgvdrmrlerhlsaedfsrvfamspeefgklalwkrne
  lkkkaelf