PDB entry 1zv4

View 1zv4 on RCSB PDB site
Description: Structure of the Regulator of G-Protein Signaling 17 (RGSZ2)
Class: signaling protein
Keywords: Human RGSZ2, Human RGS17(Z2); regulator of G-protein signaling; mu-opioid receptor interacting protein, GTPase-activating proteins (GAP), Regulator of Gz-selective protein signaling 2, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2005-06-01, released 2005-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.229
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Regulator of G-protein signaling 17
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS17
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGC6 (23-End)
      • cloning artifact (17-22)
    Domains in SCOPe 2.06: d1zv4x1, d1zv4x2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1zv4X (X:)
    mhhhhhhssgvdlgtenlyfqsmnptaeevlswsqnfdkmmkapagrnlfreflrteyse
    enllfwlacedlkkeqnkkvieekarmiyedyisilspkevsldsrvrevinrnlldpnp
    hmyedaqlqiytlmhrdsfprflnsqiyksfvestags
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zv4X (X:)
    lyfqsmnptaeevlswsqnfdkmmkapagrnlfreflrteyseenllfwlacedlkkeqn
    kkvieekarmiyedyisilpkevsldsrvrevinrnlldpnphmyedaqlqiytlmhrds
    fprflnsqiyksfvesta