PDB entry 1zux

View 1zux on RCSB PDB site
Description: EosFP Fluorescent Protein- Green Form
Class: luminescent protein
Keywords: fluorescent protein, photoconversion, peptide bond cleavage, beta-elimination, LUMINESCENT PROTEIN
Deposited on 2005-06-01, released 2005-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.211
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • GB AAV54099 (0-End)
      • chromophore (63)
    Domains in SCOPe 2.06: d1zuxa_
  • Chain 'B':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • GB AAV54099 (0-End)
      • chromophore (63)
    Domains in SCOPe 2.06: d1zuxb_
  • Chain 'C':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • GB AAV54099 (0-End)
      • chromophore (63)
    Domains in SCOPe 2.06: d1zuxc_
  • Chain 'D':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • GB AAV54099 (0-End)
      • chromophore (63)
    Domains in SCOPe 2.06: d1zuxd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zuxA (A:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zuxA (A:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zuxB (B:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zuxB (B:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zuxC (C:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zuxC (C:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zuxD (D:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zuxD (D:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpd