PDB entry 1zut

View 1zut on RCSB PDB site
Description: Crystal Structure Of Mutant K8DP9SR58K Of Scorpion alpha-Like Neurotoxin Bmk M1 From Buthus Martensii Karsch
Class: Toxin
Keywords: scorpion alpha-like toxin, bmk m1, mutant, mammal/insect selectivity
Deposited on 2005-06-01, released 2006-05-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.203
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Alpha-like neurotoxin BmK-I
  Species: Mesobuthus martensii [TaxId:34649]
  Gene: BmK M1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45697 (2-65)
    • cloning artifact (0-1)
    • engineered (9-10)
    • engineered (59)
  Domains in SCOPe 2.06: d1zuta1, d1zuta2
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zutA (A:)
  nsvrdayiadshncvyecarneycndlctkngaksgycqwvgkygngcwcielpdnvpik
  vpgkch