PDB entry 1zur

View 1zur on RCSB PDB site
Description: Crystal structure of spin labeled T4 Lysozyme (V131R1F)
Class: Hydrolase
Keywords: NITROXIDE SPIN LABEL, EPR, MODIFIED CYSTEINE, Hydrolase
Deposited on 2005-05-31, released 2006-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.191
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered mutation (53)
      • engineered mutation (96)
      • engineered mutation (130)
    Domains in SCOPe 2.08: d1zura_
  • Heterogens: R1F, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zurA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaacnlaksrwynqtpnrakrvittfrtgtwdayknl