PDB entry 1zuo

View 1zuo on RCSB PDB site
Description: Structure of Human Ubiquitin-Conjugating Enzyme (UBCi) Involved in Embryo Attachment and Implantation
Class: Ligase
Keywords: ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,sgc
Deposited on 2005-05-31, released 2005-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein LOC92912
    Species: Homo sapiens [TaxId:9606]
    Gene: LOC92912
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zuoa1
  • Chain 'B':
    Compound: Hypothetical protein LOC92912
    Species: Homo sapiens [TaxId:9606]
    Gene: LOC92912
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zuob_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zuoA (A:)
    mgsshhhhhhssglvprgsgavsgsvqasdrlmkelrdiyrsqsyktgiysvelindsly
    dwhvklqkvdpdsplhsdlqilkekegieyillnfsfkdnfpfdppfvrvvlpvlsggyv
    lgggalcmelltkqgwssaysiesvimqinatlvkgkarvqfganknqynlaraqqsyns
    ivqihe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zuoA (A:)
    gsvqasdrlmkelrdiyrsqsyktgiysvelindslydwhvklqkvdpdsplhsdlqilk
    ekegieyillnfsfkdnfpfdppfvrvvlpvlsggyvlgggalcmelltkqgwssaysie
    svimqinatlvkgkarvqfganknqynlaraqqsynsivqih
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zuoB (B:)
    mgsshhhhhhssglvprgsgavsgsvqasdrlmkelrdiyrsqsyktgiysvelindsly
    dwhvklqkvdpdsplhsdlqilkekegieyillnfsfkdnfpfdppfvrvvlpvlsggyv
    lgggalcmelltkqgwssaysiesvimqinatlvkgkarvqfganknqynlaraqqsyns
    ivqihe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zuoB (B:)
    gsvqasdrlmkelrdiyrsqsyktgiysvelindslydwhvklqkvdpdsplhsdlqilk
    ekegieyillnfsfkdnfpfdppfvrvvlpvlsggyvlgggalcmelltkqgwssaysie
    svimqinatlvkgkarvqfg