PDB entry 1zun

View 1zun on RCSB PDB site
Description: Crystal Structure of a GTP-Regulated ATP Sulfurylase Heterodimer from Pseudomonas syringae
Class: transferase
Keywords: beta barrel, switch domain, heterodimer, pyrophosphate, G protein, GTPase, TRANSFERASE
Deposited on 2005-05-31, released 2006-01-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.224
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfate adenylyltransferase subunit 2
    Species: Pseudomonas syringae [TaxId:317]
    Gene: cysD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87WW0
      • cloning artifact (13-19)
      • modified residue (20)
      • modified residue (50)
      • modified residue (61)
      • modified residue (79)
      • modified residue (90)
      • modified residue (97)
      • modified residue (101)
      • modified residue (132)
    Domains in SCOPe 2.01: d1zuna1
  • Chain 'B':
    Compound: sulfate adenylate transferase, subunit 1/adenylylsulfate kinase
    Species: Pseudomonas syringae pv. tomato str. DC3000 [TaxId:223283]
    Gene: cysNC
    Database cross-references and differences (RAF-indexed):
    • GB NP_794186 (Start-433)
      • modified residue (23)
      • modified residue (49)
      • modified residue (120)
      • modified residue (166)
      • modified residue (197)
      • modified residue (202)
      • modified residue (226)
      • modified residue (309)
      • modified residue (337)
      • modified residue (341)
      • modified residue (346)
      • modified residue (430)
    Domains in SCOPe 2.01: d1zunb1, d1zunb2, d1zunb3
  • Heterogens: MG, NA, GDP, AGS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zunA (A:)
    mgsshhhhhhssglvprgshmvdklthlkqleaesihiirevaaefdnpvmlysigkdsa
    vmlhlarkaffpgklpfpvmhvdtrwkfqemyrfrdqmveemgldlithinpdgvaqgin
    pfthgsakhtdimkteglkqaldkhgfdaafggarrdeeksrakervysfrdskhrwdpk
    nqrpelwnvyngnvnkgesirvfplsnwteldiwqyiylegipivplyfaaerdviekng
    tlimidderilehltdeeksrivkkkvrfrtlgcypltgaveseatsltdiiqemlltrt
    serqgrvidhdgagsmeekkrqgyf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zunA (A:)
    lvprgshmvdklthlkqleaesihiirevaaefdnpvmlysigkdsavmlhlarkaffpg
    klpfpvmhvdtrwkfqemyrfrdqmveemgldlithinsakhtdimkteglkqaldkhgf
    daafggarrdeeksrakervysfrdskhrwdpknqrpelwnvyngnvnkgesirvfplsn
    wteldiwqyiylegipivplyfaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zunB (B:)
    mshqsdlisedilaylgqherkemlrfltcgnvddgkstligrllhdskmiyedhleait
    rdskksgttgddvdlallvdglqaereqgitidvayryfstakrkfiiadtpgheqytrn
    matgastcdlaiilvdarygvqtqtrrhsyiasllgikhivvainkmdlngfdervfesi
    kadylkfaegiafkpttmafvpmsalkgdnvvnkserspwyagqslmeiletveiasdrn
    ytdlrfpvqyvnrpnlnfrgfagtlasgivhkgdeivvlpsgkssrvksivtfegeleqa
    gpgqavtltmedeidisrgdllvhadnvpqvsdafdamlvwmaeepmlpgkkydikrats
    yvpgsiasithrvdvntleegpasslqlneigrvkvsldapialdgyssnrttgafivid
    rltngtvaagmiia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zunB (B:)
    lgqherkemlrfltcgnvddgkstligrllhdskmigddlallvdglqaitidvayryfs
    takrkfiiadtpgheqytrnmatgastcdlaiilvdarygvqtqtrrhsyiasllgikhi
    vvainkmdlngfdervfesikadylkfaegiafkpttmafvpmsalkgdnvvnkserspw
    yagqslmeiletveiasdrnytdlrfpvqyvnrpnlnfrgfagtlasgivhkgdeivvlp
    sgkssrvksivtfegeleqagpgqavtltmedeidisrgdllvhadnvpqvsdafdamlv
    wmaeepmlpgkkydikratsyvpgsiasithrvdvntleegpasslqlneigrvkvslda
    pialdgyssnrttgafividrltngtvaagmiia