PDB entry 1zuj

View 1zuj on RCSB PDB site
Description: The crystal structure of the Lactococcus lactis MG1363 DpsA protein
Class: DNA binding protein
Keywords: Oxidative stress, Dps, DNA binding, Lactic acid bacteria, DNA BINDING PROTEIN
Deposited on 2005-05-31, released 2005-08-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.256
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Llacc01001955
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: flpA
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZUJ
    Domains in SCOPe 2.06: d1zuja1
  • Chain 'B':
    Compound: hypothetical protein Llacc01001955
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: flpA
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZUJ
    Domains in SCOPe 2.06: d1zujb_
  • Chain 'C':
    Compound: hypothetical protein Llacc01001955
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: flpA
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZUJ
    Domains in SCOPe 2.06: d1zujc_
  • Chain 'D':
    Compound: hypothetical protein Llacc01001955
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: flpA
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZUJ
    Domains in SCOPe 2.06: d1zujd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zujA (A:)
    mielsidekyeaevkkseidhhkptagamlshvlsnifyekislmqaglyaksanyrikf
    reialkedewfyliseqlldenelvpttldefvsnhkfiendpkakywtdealienfind
    fqnqnlfigraiklaqkeekfslelairklygynlsiipyfagelgktigefieeeded
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zujA (A:)
    sidekyeaevkkseidhhkptagamlshvlsnifyekislmqaglyaksanyrikfreia
    lkedewfyliseqlldenelvpttldefvsnhkfiendpkakywtdealienfindfqnq
    nlfigraiklaqkeekfslelairklygynlsiipyfagelgktigef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zujB (B:)
    mielsidekyeaevkkseidhhkptagamlshvlsnifyekislmqaglyaksanyrikf
    reialkedewfyliseqlldenelvpttldefvsnhkfiendpkakywtdealienfind
    fqnqnlfigraiklaqkeekfslelairklygynlsiipyfagelgktigefieeeded
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zujB (B:)
    sidekyeaevkkseidhhkptagamlshvlsnifyekislmqaglyaksanyrikfreia
    lkedewfyliseqlldenelvpttldefvsnhkfiendpkakywtdealienfindfqnq
    nlfigraiklaqkeekfslelairklygynlsiipyfagelgktigef
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zujC (C:)
    mielsidekyeaevkkseidhhkptagamlshvlsnifyekislmqaglyaksanyrikf
    reialkedewfyliseqlldenelvpttldefvsnhkfiendpkakywtdealienfind
    fqnqnlfigraiklaqkeekfslelairklygynlsiipyfagelgktigefieeeded
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zujC (C:)
    sidekyeaevkkseidhhkptagamlshvlsnifyekislmqaglyaksanyrikfreia
    lkedewfyliseqlldenelvpttldefvsnhkfiendpkakywtdealienfindfqnq
    nlfigraiklaqkeekfslelairklygynlsiipyfagelgktigef
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zujD (D:)
    mielsidekyeaevkkseidhhkptagamlshvlsnifyekislmqaglyaksanyrikf
    reialkedewfyliseqlldenelvpttldefvsnhkfiendpkakywtdealienfind
    fqnqnlfigraiklaqkeekfslelairklygynlsiipyfagelgktigefieeeded
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zujD (D:)
    sidekyeaevkkseidhhkptagamlshvlsnifyekislmqaglyaksanyrikfreia
    lkedewfyliseqlldenelvpttldefvsnhkfiendpkakywtdealienfindfqnq
    nlfigraiklaqkeekfslelairklygynlsiipyfagelgktigef