PDB entry 1zui

View 1zui on RCSB PDB site
Description: Structural Basis for Shikimate-binding Specificity of Helicobacter pylori Shikimate Kinase
Class: transferase
Keywords: alpha-beta protein, TRANSFERASE
Deposited on 2005-05-31, released 2006-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate kinase
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: AroK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zuia_
  • Heterogens: PO4, SKM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zuiA (A:)
    hhhhhhmqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelged
    nfrmfeknlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqkere
    krpllnnltqakelfekrqalyeknasfiidargglnnslkqvlqfia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zuiA (A:)
    qhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfek
    nlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqrekrpllnnlt
    qakelfekrqalyeknasfiidargglnnslkqvlqfi