PDB entry 1zug

View 1zug on RCSB PDB site
Description: structure of phage 434 cro protein, nmr, 20 structures
Class: transcription regulation
Keywords: gene regulating protein, transcription regulation
Deposited on 1997-03-14, released 1997-07-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phage 434 cro protein
    Species: Phage 434 [TaxId:10712]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1zuga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zugA (A:)
mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw
lqygtkrgkaa