PDB entry 1zuc

View 1zuc on RCSB PDB site
Description: Progesterone receptor ligand binding domain in complex with the nonsteroidal agonist tanaproget
Class: hormone/growth factor
Keywords: progesterone receptor, nonsteroidal agonist, tanaproget, progesterone, hormone, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2005-05-30, released 2005-07-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PGR, NR3C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zuca_
  • Chain 'B':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PGR, NR3C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zucb_
  • Heterogens: SO4, T98, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zucA (A:)
    gspgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwsk
    slpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessf
    yslcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelik
    aiglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmsevia
    aqlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zucA (A:)
    qlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrn
    lhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltm
    wqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqk
    gvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkil
    agmvkpllfhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zucB (B:)
    gspgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwsk
    slpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessf
    yslcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelik
    aiglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmsevia
    aqlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zucB (B:)
    qlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrn
    lhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltm
    wqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqk
    gvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkil
    agmvkpllfhk