PDB entry 1zub

View 1zub on RCSB PDB site
Description: Solution Structure of the RIM1alpha PDZ Domain in Complex with an ELKS1b C-terminal Peptide
Class: endocytosis/exocytosis
Keywords: PDZ domain, peptide, complex, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2005-05-30, released 2005-08-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulating synaptic membrane exocytosis protein 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Rims1, Rim1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zuba1
  • Chain 'B':
    Compound: ELKS1b
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Rab6ip2, Cast2, Elks, Erc1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zubA (A:)
    gspgshpvtwqpskegdrligrvilnkrttmpkesgallglkvvggkmtdlgrlgafitk
    vkkgsladvvghlragdevlewngkplpgatneevyniilesksepqveiivsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zubA (A:)
    hpvtwqpskegdrligrvilnkrttmpkesgallglkvvggkmtdlgrlgafitkvkkgs
    ladvvghlragdevlewngkplpgatneevyniilesksepqveiivsr
    

  • Chain 'B':
    No sequence available.