PDB entry 1zub

View 1zub on RCSB PDB site
Description: Solution Structure of the RIM1alpha PDZ Domain in Complex with an ELKS1b C-terminal Peptide
Class: endocytosis/exocytosis
Keywords: PDZ domain, peptide, complex
Deposited on 2005-05-30, released 2005-08-30
The last revision prior to the SCOP 1.75 freeze date was dated 2005-09-13, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulating synaptic membrane exocytosis protein 1
    Species: Rattus norvegicus
    Gene: Rims1, Rim1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zuba1
  • Chain 'B':
    Compound: ELKS1b
    Species: Rattus norvegicus
    Gene: Rab6ip2, Cast2, Elks, Erc1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zubA (A:)
    gspgshpvtwqpskegdrligrvilnkrttmpkesgallglkvvggkmtdlgrlgafitk
    vkkgsladvvghlragdevlewngkplpgatneevyniilesksepqveiivsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zubA (A:)
    hpvtwqpskegdrligrvilnkrttmpkesgallglkvvggkmtdlgrlgafitkvkkgs
    ladvvghlragdevlewngkplpgatneevyniilesksepqveiivsr
    

  • Chain 'B':
    No sequence available.