PDB entry 1zu3

View 1zu3 on RCSB PDB site
Description: Crystal Structure Of Mutant K8A Of Scorpion alpha-Like Neurotoxin Bmk M1 From Buthus Martensii Karsch
Class: toxin
Keywords: scorpion alpha-like toxin, bmk m1, mutant, mammal/insect selectivity
Deposited on 2005-05-30, released 2006-05-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: 0.172
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Alpha-like neurotoxin BmK-I
  Species: Mesobuthus martensii [TaxId:34649]
  Gene: BmK M1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45697 (2-65)
    • engineered (9)
  Domains in SCOPe 2.01: d1zu3a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1zu3A (A:)
  nsvrdayiaaphncvyecarneycndlctkngaksgycqwvgkygngcwcielpdnvpir
  vpgkch
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1zu3A (A:)
  vrdayiaaphncvyecarneycndlctkngaksgycqwvgkygngcwcielpdnvpirvp
  gkch