PDB entry 1zu2

View 1zu2 on RCSB PDB site
Description: Solution NMR structure of the plant Tom20 mitochondrial import receptor from Arabidopsis thaliana
Class: transport protein
Keywords: TPR, tetratricopeptide repeat like, TPR-like
Deposited on 2005-05-30, released 2005-12-06
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-21, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Mitochondrial import receptor subunit TOM20-3
  Species: Arabidopsis thaliana
  Gene: TOM20-3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P82874 (5-149)
    • cloning artifact (0-4)
    • his tag (150-157)
  Domains in SCOP 1.73: d1zu2a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zu2A (A:)
  gplgsmdtetefdrillfeqirqdaentyksnpldadnltrwggvllelsqfhsisdakq
  miqeaitkfeeallidpkkdeavwcignaytsfafltpdeteakhnfdlatqffqqavde
  qpdnthylkslemtakapqlhaeaykqglggshhhhhh