PDB entry 1zu2

View 1zu2 on RCSB PDB site
Description: Solution NMR structure of the plant Tom20 mitochondrial import receptor from Arabidopsis thaliana
Class: transport protein
Keywords: TPR, tetratricopeptide repeat like, TPR-like, TRANSPORT PROTEIN
Deposited on 2005-05-30, released 2005-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitochondrial import receptor subunit TOM20-3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: TOM20-3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82874 (5-149)
      • cloning artifact (0-4)
      • expression tag (150-157)
    Domains in SCOPe 2.07: d1zu2a1, d1zu2a2, d1zu2a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zu2A (A:)
    gplgsmdtetefdrillfeqirqdaentyksnpldadnltrwggvllelsqfhsisdakq
    miqeaitkfeeallidpkkdeavwcignaytsfafltpdeteakhnfdlatqffqqavde
    qpdnthylkslemtakapqlhaeaykqglggshhhhhh