PDB entry 1zu1

View 1zu1 on RCSB PDB site
Description: Solution Structure of the N-terminal Zinc Fingers of the Xenopus laevis double stranded RNA binding protein ZFa
Class: RNA binding protein
Keywords: zinc finger protein, helix-loop-helix, helix-turn-helix, RNA BINDING PROTEIN
Deposited on 2005-05-29, released 2005-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA binding protein ZFa
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zu1a1, d1zu1a2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zu1A (A:)
    adefgngdaldlpvgkdavnslirenshifsdtqckvcsavlisesqklahyqsrkhank
    vrrymainqgedsvpakkfkaapaeisdgedrskccpvcnmtfsspvvaeshyigkthik
    nlrlreq