PDB entry 1ztx

View 1ztx on RCSB PDB site
Description: West Nile Virus Envelope Protein DIII in complex with neutralizing E16 antibody Fab
Class: Viral protein/Immune system
Keywords: Antibody, Fab, neutralizing, Virus, Envelope, Viral protein/Immune system COMPLEX
Deposited on 2005-05-27, released 2005-10-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.208
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: envelope protein
    Species: West Nile virus [TaxId:11082]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ztxe_
  • Chain 'H':
    Compound: Heavy Chain of E16 Antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZTX (0-218)
    Domains in SCOPe 2.01: d1ztxh1
  • Chain 'L':
    Compound: Light Chain of E16 Antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZTX (0-211)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ztxE (E:)
    gsqlkgttygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvg
    rlvtvnpfvsvatanakvlieleppfgdsyivvgrgeqqinhhwhksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ztxE (E:)
    ttygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvn
    pfvsvatanakvlieleppfgdsyivvgrgeqqinhhwhks
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ztxH (H:)
    qvqlqqsgselmkpgasvqisckatgytfsdywiewvkqrpghglewigdilcgtgrtry
    neklkamatftadtssntafmqlssltsedsavyycarsasygdyadywghgttltvssa
    kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl
    ytmsssvtvpsstwpsqtvtcsvahpassttvdkkleps
    

  • Chain 'L':
    No sequence available.