PDB entry 1ztw

View 1ztw on RCSB PDB site
Description: d(CTTAATTCGAATTAAG) complexed with Moloney Murine Leukemia Virus Reverse Transcriptase catalytic fragment
Class: transferase/DNA
Keywords: MMLV RT, protein-DNA complex, drug-DNA complex, netropsin, TRANSFERASE/DNA COMPLEX
Deposited on 2005-05-27, released 2005-08-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.227
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Murine leukemia virus [TaxId:11801]
    Gene: pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ztwa_
  • Chain 'B':
    Compound: cttaattc
  • Chain 'G':
    Compound: gaattaag
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ztwA (A:)
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllkegqr

  • Chain 'B':
    No sequence available.

  • Chain 'G':
    No sequence available.