PDB entry 1ztw

View 1ztw on RCSB PDB site
Description: d(CTTAATTCGAATTAAG) complexed with Moloney Murine Leukemia Virus Reverse Transcriptase catalytic fragment
Class: transferase/DNA
Keywords: MMLV RT, protein-DNA complex, drug-DNA complex, netropsin
Deposited on 2005-05-27, released 2005-08-30
The last revision prior to the SCOP 1.75 freeze date was dated 2005-09-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.227
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Moloney murine leukemia virus
    Gene: pol
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ztwa1
  • Chain 'B':
    Compound: cttaattc
  • Chain 'G':
    Compound: gaattaag
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ztwA (A:)
    twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
    qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
    qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
    hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
    kqvkylgyllkegqr
    

  • Chain 'B':
    No sequence available.

  • Chain 'G':
    No sequence available.