PDB entry 1ztt

View 1ztt on RCSB PDB site
Description: Netropsin bound to d(CTTAATTCGAATTAAG) in complex with MMLV RT catalytic fragment
Class: Transferase/DNA
Keywords: Netropsin, MMLV-RT, Drug-DNA complex, Protein-DNA complex, Transferase/DNA COMPLEX
Deposited on 2005-05-27, released 2005-08-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.22
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Murine leukemia virus [TaxId:11801]
    Gene: pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ztta_
  • Chain 'B':
    Compound: 5'-d(*cp*tp*tp*ap*ap*tp*tp*c)-3'
  • Chain 'G':
    Compound: 5'-d(p*gp*ap*ap*tp*tp*ap*ap*g)-3'
  • Heterogens: NT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zttA (A:)
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllkegqr

  • Chain 'B':
    No sequence available.

  • Chain 'G':
    No sequence available.