PDB entry 1zts

View 1zts on RCSB PDB site
Description: Solution Structure of Bacillus Subtilis Protein YQBG: Northeast Structural Genomics Consortium Target SR215
Class: structural genomics, unknown function
Keywords: alpha, gft nmr, structural genomics, protein structure initiative, psi, nesg, sr215, northeast structural genomics consortium, cyana2.0, unknown function
Deposited on 2005-05-27, released 2005-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein yqbG
  Species: Bacillus subtilis [TaxId:1423]
  Gene: yqbG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45923 (0-130)
    • see remark 999 (97)
    • expression tag (131-138)
  Domains in SCOPe 2.08: d1ztsa1, d1ztsa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ztsA (A:)
  mllitpdelksysvfesvktrpdellkqdileatadiilkvghdfsdaeyiplpetvrla
  llklsqfyalingdesiikgyttekigdysytlgdgsslqkpdvyalikdyvkpadpdle
  gieakvrmrsilehhhhhh