PDB entry 1ztr

View 1ztr on RCSB PDB site
Description: Solution structure of Engrailed homeodomain L16A mutant
Class: transcription
Keywords: Engrailed homeodomain, denatured state, protein folding, folding intermediate, mutant, TRANSCRIPTION
Deposited on 2005-05-27, released 2005-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Segmentation polarity homeobox protein engrailed
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: en
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02836 (1-60)
      • cloning artifact (0)
      • engineered (17)
      • conflict (58-59)
    Domains in SCOPe 2.08: d1ztra1, d1ztra2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ztrA (A:)
    gdekrprtafsseqlarakrefnenrylterrrqqlsselglneaqikiwfqnkrakirr
    s