PDB entry 1ztp

View 1ztp on RCSB PDB site
Description: X-ray structure of gene product from homo sapiens Hs.433573
Class: structural genomics, unknown function
Keywords: Hs.433573, P5326, BLES03, BC010512, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, CESG, Center for Eukaryotic Structural Genomics, UNKNOWN FUNCTION
Deposited on 2005-05-27, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basophilic leukemia expressed protein BLES03
    Species: Homo sapiens [TaxId:9606]
    Gene: Hs.433573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3H3
      • modified residue (29)
      • modified residue (33)
      • modified residue (130)
    Domains in SCOPe 2.07: d1ztpa1
  • Chain 'B':
    Compound: Basophilic leukemia expressed protein BLES03
    Species: Homo sapiens [TaxId:9606]
    Gene: Hs.433573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3H3 (Start-250)
      • modified residue (29)
      • modified residue (33)
      • modified residue (130)
    Domains in SCOPe 2.07: d1ztpb_
  • Chain 'C':
    Compound: Basophilic leukemia expressed protein BLES03
    Species: Homo sapiens [TaxId:9606]
    Gene: Hs.433573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3H3
      • modified residue (29)
      • modified residue (33)
      • modified residue (130)
    Domains in SCOPe 2.07: d1ztpc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ztpA (A:)
    mepgeeleeegspggredgftaehlaaeamaadmdpwlvfdarttpateldawlakypps
    qvtrygdpgspnsepvgwiavygqgyspnsgdvqglqaawealqtsgrpitpgtlrqlai
    thhvlsgkwlmhlapgfkldhawagiaravvegrlqvakvsprakeggrqvicvytddft
    drlgvleadsairaagikclltykpdvytylgiyranrwhlcptlyesrfqlggsargsr
    vldrannvelt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ztpA (A:)
    edgftaehlaaeamaadmdpwlvfdarttpateldawlakyppsqvtrygdpgspnsepv
    gwiavygqgyspnsgdvqglqaawealqtsgrpitpgtlrqlaithhvlsgkwlmhlapg
    fkldhawagiaravvegrlqvakvsprakeggrqvicvytddftdrlgvleadsairaag
    ikclltykpdvytylgiyranrwhlcptlyesrfqgsrvldrannvel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ztpB (B:)
    mepgeeleeegspggredgftaehlaaeamaadmdpwlvfdarttpateldawlakypps
    qvtrygdpgspnsepvgwiavygqgyspnsgdvqglqaawealqtsgrpitpgtlrqlai
    thhvlsgkwlmhlapgfkldhawagiaravvegrlqvakvsprakeggrqvicvytddft
    drlgvleadsairaagikclltykpdvytylgiyranrwhlcptlyesrfqlggsargsr
    vldrannvelt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ztpB (B:)
    edgftaehlaaeamaadmdpwlvfdarttpateldawlakyppsqvtrygdpgspnsepv
    gwiavygqgyspnsgdvqglqaawealqtsgrpitpgtlrqlaithhvlsgkwlmhlapg
    fkldhawagiaravvegrlqvakvsprakeggrqvicvytddftdrlgvleadsairaag
    ikclltykpdvytylgiyranrwhlcptlyesrfqlggsargsrvldrannvelt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ztpC (C:)
    mepgeeleeegspggredgftaehlaaeamaadmdpwlvfdarttpateldawlakypps
    qvtrygdpgspnsepvgwiavygqgyspnsgdvqglqaawealqtsgrpitpgtlrqlai
    thhvlsgkwlmhlapgfkldhawagiaravvegrlqvakvsprakeggrqvicvytddft
    drlgvleadsairaagikclltykpdvytylgiyranrwhlcptlyesrfqlggsargsr
    vldrannvelt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ztpC (C:)
    maadmdpwlvfdarttpateldawlakyppsqvtrygdpgspnsepvgwiavygqgyspn
    sgdvqglqaawealqtsgrpitpgtlrqlaithhvlsgkwlmhlapgfkldhawagiara
    vvegrlqvakvsprakeggrqvicvytddftdrlgvleadsairaagikclltykpdvyt
    ylgiyranrwhlcptlyesrfqlggsargsrvldrannvel