PDB entry 1ztd

View 1ztd on RCSB PDB site
Description: Hypothetical Protein Pfu-631545-001 From Pyrococcus furiosus
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, SOUTHEAST COLLABORATORY FOR STRUCTURAL GENOMICS, SECSG, PROTEIN STRUCTURE INITIATIVE, PSI, CONSERVED HYPOTHETICAL PROTEIN, PYROCOCCUS FURIOSUS, HYPERTHERMOPHILE, Pfu-631545-001, UNKNOWN FUNCTION
Deposited on 2005-05-26, released 2005-06-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical Protein Pfu-631545-001
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ztda1
  • Chain 'B':
    Compound: Hypothetical Protein Pfu-631545-001
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ztdb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ztdA (A:)
    ahhhhhhgseidkglakfgdslinflyslalteflgkptgdrvpnaslaialeltglskn
    lrrvdkhakgdyaealiakawlmglisereaveiikknlypevldfskkkeaigralapl
    lviiserlyssqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ztdA (A:)
    seidkglakfgdslinflyslalteflgkptgdrvpnaslaialeltglsknlrrvdkha
    kgdyaealiakawlmglisereaveiikknlypevldfskkkeaigralapllviiserl
    yssqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ztdB (B:)
    ahhhhhhgseidkglakfgdslinflyslalteflgkptgdrvpnaslaialeltglskn
    lrrvdkhakgdyaealiakawlmglisereaveiikknlypevldfskkkeaigralapl
    lviiserlyssqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ztdB (B:)
    seidkglakfgdslinflyslalteflgkptgdrvpnaslaialeltglsknlrrvdkha
    kgdyaealiakawlmglisereaveiikknlypevldfskkkeaigralapllviiserl
    yssqv