PDB entry 1ztc

View 1ztc on RCSB PDB site
Description: Crystal structure of a putative metallo-beta-lactamase (tm0894) from Thermotoga maritima at 2.10 A resolution
Class: hydrolase
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, hydrolase
Deposited on 2005-05-26, released 2005-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.159
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TM0894
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm0894
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZZ6 (12-End)
      • leader sequence (10-11)
      • modified residue (12)
      • modified residue (56)
    Domains in SCOPe 2.06: d1ztca1, d1ztca2
  • Chain 'B':
    Compound: hypothetical protein TM0894
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm0894
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZZ6 (12-End)
      • leader sequence (10-11)
      • modified residue (12)
      • modified residue (56)
    Domains in SCOPe 2.06: d1ztcb2, d1ztcb3
  • Chain 'C':
    Compound: hypothetical protein TM0894
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm0894
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZZ6 (12-End)
      • leader sequence (10-11)
      • modified residue (12)
      • modified residue (56)
    Domains in SCOPe 2.06: d1ztcc2, d1ztcc3
  • Chain 'D':
    Compound: hypothetical protein TM0894
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm0894
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZZ6 (12-End)
      • leader sequence (10-11)
      • modified residue (12)
      • modified residue (56)
    Domains in SCOPe 2.06: d1ztcd2, d1ztcd3
  • Heterogens: NI, PO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ztcA (A:)
    mgsdkihhhhhhmelkilvtggnvfvpgrlnahfstvvylehkdrriiidpgnlssmdel
    eekfselgispdditdvlfthvhldhifnsvlfenatfyvhevyktknylsfgtivgriy
    skvisswknvvllkgeeslfdekvkvfhtpwharehlsflldtenagrvlitgditpnrl
    syydiikgygsvqvknfldrvgridllvfphdaplkpevkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ztcA (A:)
    hhmelkilvtggnvfvpgrlnahfstvvylehkdrriiidpgnlssmdeleekfselgis
    pdditdvlfthvhldhifnsvlfenatfyvhevyktknylsfgtivgriyskvisswknv
    vllkgeeslfdekvkvfhtpwharehlsflldtenagrvlitgditpnrlsyydiikgyg
    svqvknfldrvgridllvfphdaplkpev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ztcB (B:)
    mgsdkihhhhhhmelkilvtggnvfvpgrlnahfstvvylehkdrriiidpgnlssmdel
    eekfselgispdditdvlfthvhldhifnsvlfenatfyvhevyktknylsfgtivgriy
    skvisswknvvllkgeeslfdekvkvfhtpwharehlsflldtenagrvlitgditpnrl
    syydiikgygsvqvknfldrvgridllvfphdaplkpevkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ztcB (B:)
    hhmelkilvtggnvfvpgrlnahfstvvylehkdrriiidpgnlssmdeleekfselgis
    pdditdvlfthvhldhifnsvlfenatfyvhevyktknylsfgtivgriyskvisswknv
    vllkgeeslfdekvkvfhtpwharehlsflldtenagrvlitgditpnrlsyydiikgyg
    svqvknfldrvgridllvfphdaplkpev
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ztcC (C:)
    mgsdkihhhhhhmelkilvtggnvfvpgrlnahfstvvylehkdrriiidpgnlssmdel
    eekfselgispdditdvlfthvhldhifnsvlfenatfyvhevyktknylsfgtivgriy
    skvisswknvvllkgeeslfdekvkvfhtpwharehlsflldtenagrvlitgditpnrl
    syydiikgygsvqvknfldrvgridllvfphdaplkpevkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ztcC (C:)
    hhmelkilvtggnvfvpgrlnahfstvvylehkdrriiidpgnlssmdeleekfselgis
    pdditdvlfthvhldhifnsvlfenatfyvhevyktknylsfgtivgriyskvisswknv
    vllkgeeslfdekvkvfhtpwharehlsflldtenagrvlitgditpnrlsyydiikgyg
    svqvknfldrvgridllvfphdaplkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ztcD (D:)
    mgsdkihhhhhhmelkilvtggnvfvpgrlnahfstvvylehkdrriiidpgnlssmdel
    eekfselgispdditdvlfthvhldhifnsvlfenatfyvhevyktknylsfgtivgriy
    skvisswknvvllkgeeslfdekvkvfhtpwharehlsflldtenagrvlitgditpnrl
    syydiikgygsvqvknfldrvgridllvfphdaplkpevkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ztcD (D:)
    hhmelkilvtggnvfvpgrlnahfstvvylehkdrriiidpgnlssmdeleekfselgis
    pdditdvlfthvhldhifnsvlfenatfyvhevyktknylsfgtivgriyskvisswknv
    vllkgeeslfdekvkvfhtpwharehlsflldtenagrvlitgditpnrlsyydiikgyg
    svqvknfldrvgridllvfphdaplkpe