PDB entry 1zta

View 1zta on RCSB PDB site
Description: the solution structure of a leucine-zipper motif peptide
Class: DNA-binding motif
Keywords: DNA-binding motif
Deposited on 1990-10-11, released 1993-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: leucine zipper monomer
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-34)
  Domains in SCOPe 2.07: d1ztaa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ztaA (A:)
  lqrmkqledkveellsknyhlenevarlkklvger