PDB entry 1zta

View 1zta on RCSB PDB site
Description: the solution structure of a leucine-zipper motif peptide
Deposited on 1990-10-11, released 1993-04-15
The last revision prior to the SCOP 1.65 freeze date was dated 1993-04-15, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1zta__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zta_ (-)
    lqrmkqledkveellsknyhlenevarlkklvger