PDB entry 1zt1

View 1zt1 on RCSB PDB site
Description: crystal structure of class I MHC H-2Kk in complex with an octapeptide
Class: immune system
Keywords: peptide binding groove
Deposited on 2005-05-26, released 2005-10-18
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.212
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, K-K alpha chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04223 (1-276)
      • initiating methionine (0)
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zt1b1
  • Chain 'P':
    Compound: Influenza virus epitope, FEANGNLI
    Species: synthetic, synthetic
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zt1B (B:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zt1B (B:)
    qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
    fyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.