PDB entry 1zsz

View 1zsz on RCSB PDB site
Description: Crystal structure of a computationally designed SspB heterodimer
Class: de novo protein
Keywords: protein design, AAA, adaptor, specificity, DE NOVO PROTEIN
Deposited on 2005-05-25, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stringent starvation protein B homolog
    Species: Haemophilus influenzae [TaxId:727]
    Gene: SSPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zsza1
  • Chain 'B':
    Compound: Stringent starvation protein B homolog
    Species: Haemophilus influenzae [TaxId:727]
    Gene: SSPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45206
      • engineered (14-15)
      • engineered (100)
    Domains in SCOPe 2.07: d1zszb1
  • Chain 'C':
    Compound: Stringent starvation protein B homolog
    Species: Haemophilus influenzae [TaxId:727]
    Gene: SSPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45206
      • engineered (11)
      • engineered (14-15)
      • engineered (72)
      • engineered (100)
    Domains in SCOPe 2.07: d1zszc1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zszA (A:)
    meyksspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatg
    nlqltndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zszA (A:)
    sspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatgnlql
    tndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiyd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zszB (B:)
    meyksspkrpyllrslydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatg
    nlqltndfiqfnarfkgvsrelyipmgaalaiyarengdgamfepeeiyde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zszB (B:)
    sspkrpyllrslydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatgnlql
    tndfiqfnarfkgvsrelyipmgaalaiyarengdgamfepeeiyd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zszC (C:)
    meyksspkrpyylrgfydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatg
    nlqltndfiqfnqrfkgvsrelyipmgaalaiyarengdgmmfepeeiydelniepdteq
    ptgfyeavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zszC (C:)
    sspkrpyylrgfydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatgnlql
    tndfiqfnqrfkgvsrelyipmgaalaiyarengdgmmfepeeiydeln