PDB entry 1zsq

View 1zsq on RCSB PDB site
Description: Crystal Structure of MTMR2 in complex with phosphatidylinositol 3-phosphate
Class: Hydrolase
Keywords: Protein-Phospholipid Complex, Hydrolase
Deposited on 2005-05-25, released 2006-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.218
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myotubularin-related protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MTMR2, KIAA1073
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13614 (3-End)
      • engineered (347)
    Domains in SCOPe 2.07: d1zsqa1, d1zsqa2
  • Heterogens: EDO, PIB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zsqA (A:)
    masmeeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldasl
    gvinrvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnn
    lplfafeykevfpengwklydplleyrrqgipneswritkineryelcdtypallvvpan
    ipdeelkrvasfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimds
    naqshkififdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkei
    vypnieethwlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqlts
    lamlmldgyyrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwq
    mtrqfptafefneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqle
    dftnplygsysnhvlypvasmrhlelwvgyyirwnpraaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zsqA (A:)
    meeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvi
    nrvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlpl
    fafeykevfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipd
    eelkrvasfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaq
    shkififdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivyp
    nieethwlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslam
    lmldgyyrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtr
    qfptafefneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledft
    nplygsysnhvlypvasmrhlelwvgyyirwnp