PDB entry 1zsp

View 1zsp on RCSB PDB site
Description: Contribution to Structure and Catalysis of Tyrosine 34 in Human Manganese Superoxide Dismutase
Class: oxidoreductase
Keywords: MNSOD, MANGANESE SUPEROXIDE DISMUTASE, Y34A mutation, OXIDOREDUCTASE
Deposited on 2005-05-24, released 2006-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.236
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (33)
    Domains in SCOPe 2.07: d1zspa1, d1zspa2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (33)
    Domains in SCOPe 2.07: d1zspb1, d1zspb2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zspA (A:)
    khslpdlpydygalephinaqimqlhhskhhaaavnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zspB (B:)
    khslpdlpydygalephinaqimqlhhskhhaaavnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk