PDB entry 1zsk

View 1zsk on RCSB PDB site
Description: Crystal Structure of the Catalytic Domain of Coagulation Factor XI in Complex with 6-Carbamimidoyl-4-(3-hydroxy-2-methyl-benzoylamino)-naphthalene-2-carboxylic acid methyl ester
Class: hydrolase
Keywords: FXIa, Inhibitors, HYDROLASE
Deposited on 2005-05-24, released 2006-05-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coagulation factor XI
    Species: Homo sapiens [TaxId:9606]
    Gene: F11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03951 (0-237)
      • engineered (64)
      • engineered (67)
      • engineered (105)
      • engineered (112)
    Domains in SCOPe 2.01: d1zska_
  • Heterogens: SO4, BCT, 421, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zskA (A:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqaeiaedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpislpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav