PDB entry 1zsh

View 1zsh on RCSB PDB site
Description: Crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (IP6)
Class: signaling protein
Keywords: Nonvisual arrestins, beta-arrestins, signal transduction, SIGNALING PROTEIN
Deposited on 2005-05-24, released 2006-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-14, with a file datestamp of 2020-10-09.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-arrestin 1
    Species: Bos taurus [TaxId:9913]
    Gene: ARRB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zsha1, d1zsha2
  • Heterogens: MG, IHP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zshA (A:)
    mgdkgtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltca
    frygredldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeip
    pnlpcsvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpgp
    qptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyad
    iclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnl
    asstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpkpkeep
    phrevpehetpvdtnlieldtndddivfedfarqrlkgmkddkeeeedgtgsprlndr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zshA (A:)
    trvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafrygr
    edldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlpc
    svtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpgpqptae
    ttrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyadiclfn
    taqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnlasstl
    lreganreilgiivsykvkvklvvsssdvavelpftlmhpkdivfedfarqrlk