PDB entry 1zs9

View 1zs9 on RCSB PDB site
Description: Crystal structure of human enolase-phosphatase E1
Class: hydrolase
Keywords: structure human enolase-phosphatase e1, hydrolase
Deposited on 2005-05-23, released 2005-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.208
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E-1 enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHY7
      • modified residue (88)
      • modified residue (100)
      • modified residue (116)
      • modified residue (126)
      • modified residue (146)
    Domains in SCOPe 2.08: d1zs9a1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zs9A (A:)
    mvvlsvpaevtvilldiegtttpiafvkdilfpyieenvkeylqthweeeecqqdvsllr
    kqaeedahldgavpipaasgngvddlqqmiqavvdnvcwqmsldrkttalkqlqghmwra
    aftagrmkaeffadvvpavrkwreagmkvyiyssgsveaqkllfghstegdilelvdghf
    dtkighkvesesyrkiadsigcstnnilfltdvtreasaaeeadvhvavvvrpgnagltd
    dektyyslitsfselylpsst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs9A (A:)
    lsvpaevtvilldiegtttpiafvkdilfpyieenvkeylqthweeeecqqdvsllrkqa
    eedahldgavpipaasgngvddlqqmiqavvdnvcwqmsldkttalkqlqghmwraafta
    grmkaeffadvvpavrkwreagmkvyiyssgsveaqkllfghstegdilelvdghfdtki
    ghkvesesyrkiadsigcstnnilfltdvtreasaaeeadvhvavvvrpgnagltddekt
    yyslitsfselyl