PDB entry 1zs7

View 1zs7 on RCSB PDB site
Description: The structure of gene product APE0525 from Aeropyrum pernix
Class: structural genomics, unknown function
Keywords: Aeropyrum pernix, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-05-23, released 2005-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.168
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein APE0525
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: APE0525
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YEQ6 (2-187)
      • cloning artifact (1)
      • modified residue (2)
      • modified residue (112)
      • modified residue (141)
    Domains in SCOPe 2.07: d1zs7a1, d1zs7a2, d1zs7a3
  • Heterogens: PO4, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zs7A (A:)
    ghmlwarlvglarlearalskkerrsllerlkpyytripfsekadlrlvkartdsgeyei
    itvdgvpclfewsdgriyptlqclkafgvdwlkgvvlvdkgaaialakgahlmipgvvgv
    egsftrgdvvaalyhetrtpvmvgvaevdssaleklyrekargravrrvhrlgdalwela
    qevgkrlsgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs7A (A:)
    hmlwarlvglarlearalskkerrsllerlkpyytripfsekadlrlvkartdsgeyeii
    tvdgvpclfewsdgriyptlqclkafgvdwlkgvvlvdkgaaialakgahlmipgvvgve
    gsftrgdvvaalyhetrtpvmvgvaevdssaleklyrekargravrrvhrlgdalwelaq
    evgkrls