PDB entry 1zs6

View 1zs6 on RCSB PDB site
Description: structure of human nucleoside-diphosphate kinase 3
Class: transferase
Keywords: nucleotide metabolism, apoptosis, kinase, transferase, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2005-05-23, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: NME3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zs6a1
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: NME3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zs6b_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: NME3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zs6d_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zs6A (A:)
    miclvltifanlfpaactgahertflavkpdgvqrrlvgeivrrferkgfklvalklvqa
    seellrehyaelrerpfygrlvkymasgpvvamvwqgldvvrtsraligatnpadappgt
    irgdfcievgknlihgsdsvesarreialwfradellcwedsaghwlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs6A (A:)
    tgahertflavkpdgvqrrlvgeivrrferkgfklvalklvqaseellrehyaelrerpf
    ygrlvkymasgpvvamvwqgldvvrtsraligatnpadappgtirgdfcievgknlihgs
    dsvesarreialwfradellcwedsaghwlye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zs6B (B:)
    miclvltifanlfpaactgahertflavkpdgvqrrlvgeivrrferkgfklvalklvqa
    seellrehyaelrerpfygrlvkymasgpvvamvwqgldvvrtsraligatnpadappgt
    irgdfcievgknlihgsdsvesarreialwfradellcwedsaghwlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs6B (B:)
    tgahertflavkpdgvqrrlvgeivrrferkgfklvalklvqaseellrehyaelrerpf
    ygrlvkymasgpvvamvwqgldvvrtsraligatnpadappgtirgdfcievgknlihgs
    dsvesarreialwfradellcwedsaghwlye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zs6D (D:)
    miclvltifanlfpaactgahertflavkpdgvqrrlvgeivrrferkgfklvalklvqa
    seellrehyaelrerpfygrlvkymasgpvvamvwqgldvvrtsraligatnpadappgt
    irgdfcievgknlihgsdsvesarreialwfradellcwedsaghwlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs6D (D:)
    tgahertflavkpdgvqrrlvgeivrrferkgfklvalklvqaseellrehyaelrerpf
    ygrlvkymasgpvvamvwqgldvvrtsraligatnpadappgtirgdfcievgknlihgs
    dsvesarreialwfradellcwedsaghwlye