PDB entry 1zs3

View 1zs3 on RCSB PDB site
Description: The crystal structure of the Lactococcus lactis MG1363 DpsB protein
Class: DNA Binding Protein
Keywords: Oxidative stress, Dps, DNA binding, Lactic acid bacteria, DNA Binding Protein
Deposited on 2005-05-23, released 2005-08-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.209
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lactococcus lactis MG1363 DpsA
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: flpB
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZS3
    Domains in SCOPe 2.06: d1zs3a1
  • Chain 'B':
    Compound: Lactococcus lactis MG1363 DpsA
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: flpB
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZS3
    Domains in SCOPe 2.06: d1zs3b_
  • Chain 'C':
    Compound: Lactococcus lactis MG1363 DpsA
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: flpB
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZS3
    Domains in SCOPe 2.06: d1zs3c_
  • Chain 'D':
    Compound: Lactococcus lactis MG1363 DpsA
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: flpB
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZS3
    Domains in SCOPe 2.06: d1zs3d_
  • Chain 'E':
    Compound: Lactococcus lactis MG1363 DpsA
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: flpB
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZS3
    Domains in SCOPe 2.06: d1zs3e_
  • Chain 'F':
    Compound: Lactococcus lactis MG1363 DpsA
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: flpB
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZS3
    Domains in SCOPe 2.06: d1zs3f_
  • Chain 'G':
    Compound: Lactococcus lactis MG1363 DpsA
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: flpB
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZS3
    Domains in SCOPe 2.06: d1zs3g_
  • Chain 'H':
    Compound: Lactococcus lactis MG1363 DpsA
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: flpB
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZS3
    Domains in SCOPe 2.06: d1zs3h_
  • Chain 'I':
    Compound: Lactococcus lactis MG1363 DpsA
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: flpB
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZS3
    Domains in SCOPe 2.06: d1zs3i_
  • Chain 'J':
    Compound: Lactococcus lactis MG1363 DpsA
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: flpB
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZS3
    Domains in SCOPe 2.06: d1zs3j_
  • Chain 'K':
    Compound: Lactococcus lactis MG1363 DpsA
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: flpB
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZS3
    Domains in SCOPe 2.06: d1zs3k_
  • Chain 'L':
    Compound: Lactococcus lactis MG1363 DpsA
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: flpB
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZS3
    Domains in SCOPe 2.06: d1zs3l_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zs3A (A:)
    mitklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkcey
    lreiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfiv
    dfqaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadfhdededn
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs3A (A:)
    tklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkceylr
    eiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfivdf
    qaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zs3B (B:)
    mitklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkcey
    lreiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfiv
    dfqaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadfhdededn
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs3B (B:)
    tklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkceylr
    eiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfivdf
    qaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zs3C (C:)
    mitklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkcey
    lreiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfiv
    dfqaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadfhdededn
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs3C (C:)
    tklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkceylr
    eiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfivdf
    qaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zs3D (D:)
    mitklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkcey
    lreiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfiv
    dfqaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadfhdededn
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs3D (D:)
    tklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkceylr
    eiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfivdf
    qaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1zs3E (E:)
    mitklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkcey
    lreiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfiv
    dfqaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadfhdededn
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs3E (E:)
    tklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkceylr
    eiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfivdf
    qaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1zs3F (F:)
    mitklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkcey
    lreiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfiv
    dfqaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadfhdededn
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs3F (F:)
    tklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkceylr
    eiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfivdf
    qaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1zs3G (G:)
    mitklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkcey
    lreiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfiv
    dfqaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadfhdededn
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs3G (G:)
    tklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkceylr
    eiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfivdf
    qaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1zs3H (H:)
    mitklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkcey
    lreiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfiv
    dfqaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadfhdededn
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs3H (H:)
    tklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkceylr
    eiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfivdf
    qaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1zs3I (I:)
    mitklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkcey
    lreiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfiv
    dfqaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadfhdededn
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs3I (I:)
    tklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkceylr
    eiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfivdf
    qaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1zs3J (J:)
    mitklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkcey
    lreiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfiv
    dfqaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadfhdededn
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs3J (J:)
    tklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkceylr
    eiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfivdf
    qaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadf
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1zs3K (K:)
    mitklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkcey
    lreiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfiv
    dfqaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadfhdededn
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs3K (K:)
    tklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkceylr
    eiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfivdf
    qaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadf
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1zs3L (L:)
    mitklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkcey
    lreiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfiv
    dfqaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadfhdededn
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zs3L (L:)
    tklmidekyakeldkaeidhhkptagamlghvlsnlfienirltqagiyakspvkceylr
    eiaqreveyffkisdllldeneivpstteeflkyhkfitedpkakywtdedllesfivdf
    qaqnmfitraiklankeekfalaagvvelygynlqvirnlagdlgksvadf