PDB entry 1zs2

View 1zs2 on RCSB PDB site
Description: Amylosucrase Mutant E328Q in a ternary complex with sucrose and maltoheptaose
Class: transferase
Keywords: ternary complex, (BETA/ALPHA)8-BARREL,, TRANSFERASE
Deposited on 2005-05-23, released 2006-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.178
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amylosucrase
    Species: Neisseria polysaccharea [TaxId:489]
    Database cross-references and differences (RAF-indexed):
    • GB CAA09772 (4-627)
      • cloning artifact (0-3)
      • see remark 999 (130)
      • engineered (327)
    Domains in SCOPe 2.07: d1zs2a1, d1zs2a2, d1zs2a3
  • Heterogens: SUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zs2A (A:)
    spnsqylktrildiytpeqragieksedwrqfsrrmdthfpklmneldsvygnneallpm
    lemllaqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglkdkip
    yfqelgltylylmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheagisav
    vdfifnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlreifpdqhpggfsql
    edgrwvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdavafiwkqmgtsce
    nlpqahalirafnavmriaapavffksqaivhpdqvvqyigqdecqigynplqmallwnt
    latrevnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrqflnr
    ffvnrfdgsfargvpfqynpstgdcrvsgtaaalvglaqddphavdrikllysialstgg
    lpliylgdevgtlndddwsqdsnksddsrwahrprynealyaqrndpstaagqiyqglrh
    miavrqsnprfdggrlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfka
    hdliggktvslnqdltlqpyqvmwleia