PDB entry 1zry

View 1zry on RCSB PDB site
Description: NMR structural analysis of apo chicken liver bile acid binding protein
Class: lipid binding protein
Keywords: beta barrel, lipid binding protein
Deposited on 2005-05-23, released 2006-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fatty acid-binding protein, liver
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80226 (0-124)
  Domains in SCOPe 2.08: d1zrya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zryA (A:)
  afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn
  sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir
  rskrv