PDB entry 1zru

View 1zru on RCSB PDB site
Description: structure of the lactophage p2 receptor binding protein in complex with glycerol
Class: virus/viral protein
Keywords: 3 domains: BETA BARREL, BETA PRISM, BETA BARREL, Structural Genomics, Structural Proteomics in Europe, SPINE
Deposited on 2005-05-22, released 2006-03-28
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.175
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactophage p2 receptor binding protein
    Species: Lactococcus lactis phage p2
    Gene: ORF 18
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zrua1, d1zrua2, d1zrua3
  • Chain 'B':
    Compound: lactophage p2 receptor binding protein
    Species: Lactococcus lactis phage p2
    Gene: ORF 18
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zrub1, d1zrub2, d1zrub3
  • Chain 'C':
    Compound: lactophage p2 receptor binding protein
    Species: Lactococcus lactis phage p2
    Gene: ORF 18
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zruc1, d1zruc2, d1zruc3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zruA (A:)
    mtiknftffspnstefpvgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsi
    iaggryfellnetvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlk
    vcfdivttsgtgvtstkpivqtstldsisvndmtvsgsidvpvqtltveagnglqlqltk
    knndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngs
    itwwganidktpiatrgngsyfik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zruA (A:)
    tiknftfgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsiiaggryfelln
    etvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlkvcfdivttsgt
    gvtstkpivqtstldsisvndmtvsgsidvpvqtltveagnglqlqltkknndlvivrff
    gsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngsitwwganidkt
    piatrgngsyfik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zruB (B:)
    mtiknftffspnstefpvgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsi
    iaggryfellnetvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlk
    vcfdivttsgtgvtstkpivqtstldsisvndmtvsgsidvpvqtltveagnglqlqltk
    knndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngs
    itwwganidktpiatrgngsyfik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zruB (B:)
    tiknfgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsiiaggryfellnet
    valkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlkvcfdivttsgtgv
    tstkpivqtstldsisvndmtvsgsidvpvqtltveagnglqlqltkknndlvivrffgs
    vsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngsitwwganidktpi
    atrgngsyfik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zruC (C:)
    mtiknftffspnstefpvgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsi
    iaggryfellnetvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlk
    vcfdivttsgtgvtstkpivqtstldsisvndmtvsgsidvpvqtltveagnglqlqltk
    knndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngs
    itwwganidktpiatrgngsyfik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zruC (C:)
    tiknftffgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsiiaggryfell
    netvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlkvcfdivttsg
    tgvtstkpivqtstldsisvndmtvsgsidvpvqtltveagnglqlqltkknndlvivrf
    fgsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngsitwwganidk
    tpiatrgngsyfik