PDB entry 1zrs

View 1zrs on RCSB PDB site
Description: wild-type LD-carboxypeptidase
Class: Hydrolase
Keywords: LD-carboxypeptidase, peptidoglycan hydrolase, serine peptidase, serine-histidine-glutamate triad, nucleophilic elbow, Hydrolase
Deposited on 2005-05-21, released 2005-09-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.164
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTZ1 (Start-316)
      • variant (39)
      • variant (113)
    Domains in SCOPe 2.05: d1zrsa1, d1zrsa2
  • Chain 'B':
    Compound: hypothetical protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTZ1 (Start-316)
      • variant (39)
      • variant (113)
    Domains in SCOPe 2.05: d1zrsb1, d1zrsb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zrsA (A:)
    mghhhhhhefmtsrpssdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgr
    hvearyrylagtveqrledlhnafdmpditavwclrggygcgqllpgldwgrleaasprp
    ligfsdisvllsafhrhglpaihgpvatglglsplsapreqqerlaslasvsrllagidh
    elpvqhlgghkqrvegaliggnltalacmagtlgglhapagsilvledvgepyyrlersl
    wqllesidarqlgaiclgsftdcprkevahslerifgeyaaaievplyhhlpsghgaqnr
    awpygktavlegnrlrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zrsA (A:)
    pssdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgrhvearyrylagtve
    qrledlhnafdmpditavwclrggygcgqllpgldwgrleaasprpligfsdisvllsaf
    hrhglpaihgpvatglglqerlaslasvsrllagidhelpvqhlgghkqrvegaliggnl
    talacmagtlgglhapagsilvledvgepyyrlerslwqllesidarqlgaiclgsftdc
    prkevahslerifgeyaaaievplyhhlpsghgaqnrawpygktavlegnrlrw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zrsB (B:)
    mghhhhhhefmtsrpssdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgr
    hvearyrylagtveqrledlhnafdmpditavwclrggygcgqllpgldwgrleaasprp
    ligfsdisvllsafhrhglpaihgpvatglglsplsapreqqerlaslasvsrllagidh
    elpvqhlgghkqrvegaliggnltalacmagtlgglhapagsilvledvgepyyrlersl
    wqllesidarqlgaiclgsftdcprkevahslerifgeyaaaievplyhhlpsghgaqnr
    awpygktavlegnrlrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zrsB (B:)
    sdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgrhvearyrylagtveqr
    ledlhnafdmpditavwclrggygcgqllpgldwgrleaasprpligfsdisvllsafhr
    hglpaihgpvatglgleqqerlaslasvsrllagidhelpvqhlgghkqrvegaliggnl
    talacmagtlgglhapagsilvledvgepyyrlerslwqllesidarqlgaiclgsftdc
    prkevahslerifgeyaaaievplyhhlpsghgaqnrawpygktavlegnrlrw