PDB entry 1zrr

View 1zrr on RCSB PDB site
Description: Residual Dipolar Coupling Refinement of Acireductone Dioxygenase from Klebsiella
Class: Oxidoreductase
Keywords: nickel, cupin, beta helix, methionine salvage
Deposited on 2005-05-19, released 2005-12-06
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-24, with a file datestamp of 2007-06-04.
Experiment type: NMR17
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: E-2/E-2' protein
  Species: Klebsiella oxytoca
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9ZFE7 (0-178)
  Domains in SCOP 1.73: d1zrra1
• Heterogens: NI, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zrrA (A:)
  saltifsvkdpqnslwhstnaeeiqqqlnakgvrferwqadrdlgaaptaetviaayqha
  idklvaekgyqswdvislradnpqkealrekflnehthgedevrffvegaglfclhigde
  vfqvlcekndlisvpahtphwfdmgsepnftairifdnpegwiaqftgddiasayprla