PDB entry 1zrr

View 1zrr on RCSB PDB site
Description: Residual Dipolar Coupling Refinement of Acireductone Dioxygenase from Klebsiella
Class: Oxidoreductase
Keywords: nickel, cupin, beta helix, methionine salvage, Oxidoreductase
Deposited on 2005-05-19, released 2005-12-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E-2/E-2' protein
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zrra_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zrrA (A:)
    saltifsvkdpqnslwhstnaeeiqqqlnakgvrferwqadrdlgaaptaetviaayqha
    idklvaekgyqswdvislradnpqkealrekflnehthgedevrffvegaglfclhigde
    vfqvlcekndlisvpahtphwfdmgsepnftairifdnpegwiaqftgddiasayprla