PDB entry 1zrp

View 1zrp on RCSB PDB site
Description: solution-state structure by nmr of zinc-substituted rubredoxin from the marine hyperthermophilic archaebacterium pyrococcus furiosus
Class: electron transport
Keywords: electron transport
Deposited on 1992-07-10, released 1993-10-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1zrpa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zrpA (A:)
    akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled