PDB entry 1zro

View 1zro on RCSB PDB site
Description: Crystal structure of EBA-175 Region II (RII) crystallized in the presence of (alpha)2,3-sialyllactose
Class: cell invasion
Keywords: EBA-175, RII, DBL, erythrocyte, invasion, host, malaria, disease, glycophorin, glycan, sialic acid, binding, sialyllactose, CELL INVASION
Deposited on 2005-05-19, released 2005-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: erythrocyte binding antigen region II
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q25735
      • engineered (49)
      • engineered (194)
      • engineered (205)
    Domains in SCOPe 2.07: d1zroa1, d1zroa2
  • Chain 'B':
    Compound: erythrocyte binding antigen region II
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q25735
      • engineered (49)
      • engineered (194)
      • engineered (205)
    Domains in SCOPe 2.07: d1zrob1, d1zrob2
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zroA (A:)
    grqtssnnevlsncrekrkgmkwdckkkndrsnyvcipdrriqlcivnlaiiktytketm
    kdhfieaskkesqlllkkndnkynskfcndlknsfldyghlamgndmdfggystkaenki
    qevfkgahgeisehkiknfrkkwwnefreklweamlsehknninncknipqeelqitqwi
    kewhgefllerdnraklpkskcknnalyeacekecidpcmkyrdwiirskfewhtlskey
    etqkvpkenaenylikisenkndakvslllnncdaeyskycdckhtttlvksvlngndnt
    ikekrehidlddfskfgcdknsvdtntkvweckkpyklstkdvcvpprrqelclgnidri
    ydknllmikehilaiaiyesrilkrkyknkddkevckiinktfadirdiiggtdywndls
    nrklvgkintnsnyvhrnkqndklfrdewwkvikkdvwnviswvfkdktvckeddienip
    qffrwfsewgddycqdktkmietlkveckekpceddnckrkcnsykewiskkkeeynkqa
    kqyqeyqkgnnykmysefksikpevylkkysekcsnlnfedefkeelhsdyknkctmcpe
    vk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zroA (A:)
    nevlsncrekrkgmkwdckkkndrsnyvcipdrriqlcivnlaiiktytketmkdhfiea
    skkesqlllkkndnkynskfcndlknsfldyghlamgndmdfggystkaenkiqevfkga
    hgeisehkiknfrkkwwnefreklweamlsehknnicknipqeelqitqwikewhgefll
    erdnraklpkskcknnalyeacekecidpcmkyrdwiirskfewhtlskeyetqkvpken
    aenylikisenkndakvslllnncdaeyskycdckhtttlvksvlngndntikekrehid
    lddfskfgcdknsvdtntkvweckkpyklstkdvcvpprrqelclgnidriydknllmik
    ehilaiaiyesrilkrkyknkddkevckiinktfadirdiiggtdywndlsnrklvgkin
    tnsnyvhrnkqndklfrdewwkvikkdvwnviswvfkdktvckeddienipqffrwfsew
    gddycqdktkmietlkvecceddnckrkcnsykewiskkkeeynkqakqyqeyqkgnnyk
    mysefksikpevylkkysekcsnlnfedefkeelhsdyknkctmcpev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zroB (B:)
    grqtssnnevlsncrekrkgmkwdckkkndrsnyvcipdrriqlcivnlaiiktytketm
    kdhfieaskkesqlllkkndnkynskfcndlknsfldyghlamgndmdfggystkaenki
    qevfkgahgeisehkiknfrkkwwnefreklweamlsehknninncknipqeelqitqwi
    kewhgefllerdnraklpkskcknnalyeacekecidpcmkyrdwiirskfewhtlskey
    etqkvpkenaenylikisenkndakvslllnncdaeyskycdckhtttlvksvlngndnt
    ikekrehidlddfskfgcdknsvdtntkvweckkpyklstkdvcvpprrqelclgnidri
    ydknllmikehilaiaiyesrilkrkyknkddkevckiinktfadirdiiggtdywndls
    nrklvgkintnsnyvhrnkqndklfrdewwkvikkdvwnviswvfkdktvckeddienip
    qffrwfsewgddycqdktkmietlkveckekpceddnckrkcnsykewiskkkeeynkqa
    kqyqeyqkgnnykmysefksikpevylkkysekcsnlnfedefkeelhsdyknkctmcpe
    vk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zroB (B:)
    nevlsncrekrkgmkwdckkkndrsnyvcipdrriqlcivnlaiiktytketmkdhfiea
    skkesqlllkkndnkynskfcndlknsfldyghlamgndmdfggystkaenkiqevfkga
    hgeisehkiknfrkkwwnefreklweamlsehknnicknipqeelqitqwikewhgefll
    erdnraklpkskcknnalyeacekecidpcmkyrdwiirskfewhtlskeyetqkvpken
    aenylikisenkndakvslllnncdaeyskycdckhtttlvksvlngndntikekrehid
    lddfskfgcdknsvdtntkvweckkpyklstkdvcvpprrqelclgnidriydknllmik
    ehilaiaiyesrilkrkyknkddkevckiinktfadirdiiggtdywndlsnrklvgkin
    tnsnyvhrnkqndklfrdewwkvikkdvwnviswvfkdktvckeddienipqffrwfsew
    gddycqdktkmietlkvecceddnckrkcnsykewiskkkeeynkqakqyqeyqkgnnyk
    mysefksikpevylkkysekcsnlnfedefkeelhsdyknkctmcpev