PDB entry 1zrj

View 1zrj on RCSB PDB site
Description: Solution structure of the SAP domain of human E1B-55kDa-associated protein 5 isoform c
Class: DNA binding protein
Keywords: SAP domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E1B-55kDa-associated protein 5 isoform c
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRPUL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BUJ2 (7-43)
      • expression tag (0-6)
      • expression tag (44-49)
    Domains in SCOPe 2.06: d1zrja1, d1zrja2, d1zrja3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zrjA (A:)
    gssgssgmdvrrlkvnelreelqrrgldtrglkaelaerlqaalsgpssg