PDB entry 1zre

View 1zre on RCSB PDB site
Description: 4 crystal structures of CAP-DNA with all base-pair substitutions at position 6, CAP-[6G;17C]ICAP38 DNA
Class: gene regulation/DNA
Keywords: protein-DNA complex, cap, cap-DNA, catabolite gene activator protein, camp receptor protein, crp, gene regulation-DNA complex
Deposited on 2005-05-19, released 2006-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:562]
    Gene: crp, cap, csm
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zrea1, d1zrea2
  • Chain 'B':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:562]
    Gene: crp, cap, csm
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zreb1, d1zreb2
  • Chain 'W':
    Compound: 5'-d(*ap*tp*tp*tp*cp*gp*ap*ap*ap*ap*ap*tp*gp*gp*gp*ap*t)-3'
  • Chain 'X':
    Compound: 5'-d(*cp*tp*ap*gp*ap*tp*cp*cp*cp*ap*tp*tp*tp*tp*tp*cp*gp*ap*ap*ap*t)-3'
  • Chain 'Y':
    Compound: 5'-d(*ap*tp*tp*tp*cp*gp*ap*ap*ap*ap*ap*tp*gp*gp*gp*ap*t)-3'
  • Chain 'Z':
    Compound: 5'-d(*cp*tp*ap*gp*ap*tp*cp*cp*cp*ap*tp*tp*tp*tp*tp*cp*gp*ap*ap*ap*t)-3'
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zreA (A:)
    vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi
    lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm
    arrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsr
    etvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zreA (A:)
    dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
    dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
    sekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgril
    kmledqnlisahgktivvyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zreB (B:)
    vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi
    lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm
    arrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsr
    etvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zreB (B:)
    dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
    dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
    sekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgril
    kmledqnlisahgktivvyg
    

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.