PDB entry 1zr7

View 1zr7 on RCSB PDB site
Description: Solution structure of the first WW domain of FBP11
Class: signaling protein
Keywords: beta sheet, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-05-19, released 2006-05-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Huntingtin-interacting protein HYPA/FBP11
  Species: Homo sapiens [TaxId:9606]
  Gene: FBP11
  Database cross-references and differences (RAF-indexed):
  • GB AAC27506 (2-29)
    • cloning artifact (0-1)
  Domains in SCOPe 2.06: d1zr7a1, d1zr7a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zr7A (A:)
  gswtehkspdgrtyyyntetkqstwekpdd