PDB entry 1zr0

View 1zr0 on RCSB PDB site
Description: Crystal Structure of Kunitz Domain 1 of Tissue Factor Pathway Inhibitor-2 with Bovine Trypsin
Class: hydrolase/blood clotting
Keywords: serine protease; complex of serine protease/inhibitor; Kunitz type inhibitor, HYDROLASE/BLOOD CLOTTING COMPLEX
Deposited on 2005-05-18, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.231
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • conflict (79)
    Domains in SCOPe 2.07: d1zr0a_
  • Chain 'B':
    Compound: Tissue factor pathway inhibitor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TFPI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zr0b1
  • Chain 'C':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • conflict (79)
    Domains in SCOPe 2.07: d1zr0c_
  • Chain 'D':
    Compound: Tissue factor pathway inhibitor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TFPI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zr0d_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zr0A (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilstsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zr0B (B:)
    ptgnnaeicllpldygpcralllryyydrytqscrqflyggcegnannfytweacddacw
    rie
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zr0C (C:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilstsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zr0D (D:)
    ptgnnaeicllpldygpcralllryyydrytqscrqflyggcegnannfytweacddacw
    rie